Protein Labeling Reagents
Medchemexpress LLC (±)-ANAP hydrochloride | 2308035-47-2 | 98.5% | 308.76 | C15H17ClN2O3 | 10 MG
(±)-ANAP hydrochloride is a fluorescent, unnatural amino-acid analog of prodan used as an environment-sensitive probe in biochemical and biophysical studies. It displays polarity-dependent changes in fluorescence intensity and emission wavelength, allowing monitoring of local microenvironments when incorporated site-specifically into peptides or proteins. The compound is supplied as a solid hydrochloride salt with storage recommendations to minimize exposure to moisture and light.
- Sensitive to polarity with changes in intensity and emission wavelength.
- Suitable for site-specific incorporation into peptides and proteins.
- Enables monitoring of local microenvironmental changes.
- High purity appropriate for research applications.
- Stable as a solid; store sealed away from moisture and light at 4°C.
- Available in small package sizes for screening and synthesis.
CPC Scientific FAM-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH (trifluoroacetate salt) 0.5MG
beta-Amyloid (1-40) found to exhibit both neurotrophic and neurotoxic effects that depend on neuronal age and beta-protein concentration.ONE-LETTER SEQUENCE: FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVMOLECULAR FORMULA: C215H305N53O64S1MOLECULAR WEIGHT:4688.2STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [1678416-08-4], SYNONYMS: 5-FAM-Amyloid β-Protein (1-40)RESEARCH AREA: Alzheimer's DiseaseREFERENCES: B.A. Yankner et al., Science, 250, 279 (1990)
LICOR IRDye QC-1 NHS Ester (5.0 mg)
IRDye QC-1 is the first non-fluorescent (dark) quencher compatible with a wide range of visible and near-infrared fluorophores (~500-800 nm). It has the widest available quenching range, so you do not need to carefully match the donor's fluorescence spectrum with the acceptor's absorbance. IRDye QC-1 NHS ester can be used for FRET (fluorescence resonance energy transfer) applications such as protease assays. Recently, it has been paired with IRDye 800CW in optoacoustic studies.
Selleck Chemical LLC Maleimide S3141-100mg
Maleimide exhibits fluorescence quenching ability and can be used for the specific detection of thiol analytes as fluorogenic probes Maleimide is also used for production of antibody-drug conjugate (ADC) which is used in cancer research
Medchemexpress LLC HY-D0893 5mg Medchemexpress, NSP-SA-NHS CAS:199293-83-9 Purity:>98%
Medchemexpress, HY-D0893 5mg NSP-SA-NHS CAS:199293-83-9 NSP-SA-NHS is a chemiluminescent acridinium ester. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
CPC Scientific TAMRA-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH (trifluoroacetate salt) 0.5MG
beta-Amyloid (1-40) found to exhibit both neurotrophic and neurotoxic effects that depend on neuronal age and beta-protein concentration.ONE-LETTER SEQUENCE: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVMOLECULAR FORMULA: C219H315N55O62S1MOLECULAR WEIGHT:4742.4STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [1802087-81-5], SYNONYMS: 5-TAMRA-Amyloid β-Protein (1-40)RESEARCH AREA: Alzheimer's DiseaseREFERENCES: B.A. Yankner et al., Science, 250, 279 (1990)
Apexbio Technology LLC Cy3 NHS ester, 25mg. Cas: MFCD: MFCD28505569. Labeling of amino-groups in biomolecules.
Sulfo-Cy3 NHS ester is a sulfonated, hydrophilic and highly water soluble dye. For labeling proteins and peptides, no organic co-solvent is needed. Other sizes are available. Please inqury us for quote.
CPC Scientific FAM-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH (trifluoroacetate salt) 0.5MG
Pituitary hormone N-terminal synthetic fragment that stimulates the corticosteroid synthesis and secretion in the adrenal cortex. This peptide is more active than ACTH in terms of corticosteroid releasing activity in vitro.ONE-LETTER SEQUENCE: Fam-SYSMEHFRWGKPVGKKRRPVKVYPMOLECULAR FORMULA: C157H220N40O37S1MOLECULAR WEIGHT:3291.8STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [16960-16-0], RESEARCH AREA: HormonalREFERENCES: Y.F.Jacquet, Science, 201, 1032 (1978)
Biotium VivoBrite™ Rapid Antibody Labeling Kit for Small Animal In Vivo Imaging, CF770 SE
This labeling kit comprises our superior near-IR amine-reactive CF dye and other components necessary for carrying out antibody labeling, purification, and filter sterilization. CF dyes are Biotium's line of next-generation fluorescent dyes with advantages in brightness, photostability, and conjugate specificity compared to other fluorescent dyes. Near-infrared fluorescent CF770 dye has excitation/emission at 770/797 nm.
Biocare Medical, LLC Reveal Decloaker, 10X - 500 ml
Reveal Decloaker is a heat retrieval solution that is suitable for most antibody-antigen staining and reduces non-specific background staining, blocks endogenous peroxidase and removes mercury crystals. Reveal Decloaker can be used with Biocare's digital electric pressure cooker (Decloaking Chamber), a steamer, a water bath, or a microwave oven. For many antibodies, titers are doubled and background staining is significantly reduced when compared to citrate buffer, pH 6.0. Reveal Decloaker incorporates Assure technology, a color-coded high temperature pH indicator solution. The end-user is assured by visual inspection that the solution is at the correct dilution and pH. This product is specially formulated for superior pH stability at high temperatures and will help prevent the possibility of losing pH sensitive antigens. Reveal Decloaker is non-toxic, non-flammable, odorless and sodium azide and thimerosal free.
Bioworld Glow Cyanoblue Dye, 5 mL
Premixed and ready-to-load gel dyes. Glow Loading Dyes generate intense DNA/RNA bands with little background or band distortion and can be used with any type of agarose or acrylamide gels. Glow CyanoBlue dye contains bromophenol blue and xylene cyanol in a ficoll-based solution with ethidium bromide (6X concentration).
CPC Scientific TAMRA-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (trifluoroacetate salt) 0.5MG
Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).ONE-LETTER SEQUENCE: TAMRA-SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Cys10 and 26 bridge)MOLECULAR FORMULA: C168H266N52O46S4MOLECULAR WEIGHT:3878.6STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [114471-18-0], RESEARCH AREA: CardiovascularREFERENCES: T. Sudoh et al., BBRC, 159, 1427 (1989)
Vector Laboratories NEUROBIOTIN Tracer
NEUROBIOTIN Tracer (SP-1120) is an amino derivative of biotin that can be used as an intracellular label for cells, particularly neurons. It is used for visualizing neural architecture and for the identification of gap junction coupling. Can be used in many types of preparations including in vivo, whole mounts, slice preparations, or cultured cells - Can be delivered by many routes such as intracellular electrodes, microinjection, cut-loading, or scrape-loading - Can be detected using avidin or streptavidin systems with either chromogenic or fluorescence visualization methods
Medchemexpress LLC Cy5-PEG3-azide | 00-00-0 | C40H55ClN6O4 | 10MG
Cy5-PEG3-azide is a Cy5-labeled PEG3 azide reagent for click-chemistry labeling and linker applications. It enables copper-catalyzed azide-alkyne cycloaddition (CuAAC) and strain-promoted alkyne-azide cycloaddition (SPAAC) to attach Cy5 fluorescence to alkyne-bearing molecules for bioconjugation, imaging, and PROTAC synthesis.
- Provides Cy5 fluorescence for detection and imaging.
- Contains a PEG3 spacer to improve solubility and reduce steric hindrance.
- Reactive azide functional group for CuAAC and SPAAC conjugations.
- Supplied as a dry powder for convenient storage and handling.
- Store protected from light at -20°C; in solvent, store at -80°C for long-term.
Medchemexpress LLC HY-15939 10mg Medchemexpress, 6-FAM SE CAS:92557-81-8 Purity:>98%
Medchemexpress, HY-15939 10mg 6-FAM SE CAS:92557-81-8 Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.